Vrnt.org valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | VRNT |
| Description | Veda Rakshna Nidhi Trust |
| Keywords | Veda Rakshna Nidhi Trust, vrnt |
Server Information
| WebSite | |
| Host IP | 78.142.47.8 |
| Location | Sofia, Sofia-Capital, Bulgaria |
Related Websites
| Site | Rank |
| srikanchimahaswamividyamandir.org | #7,288,957 |
| vedavyasa.org | #2,172,458 |
More to Explore
Vrnt.org Valuation
|
US$32,312
Last updated: Mar 28, 2021
Vrnt.org has global traffic rank of 3,676,356. Vrnt.org has an estimated worth of US$ 32,312, based on its estimated Ads revenue. Vrnt.org receives approximately 843 unique visitors each day. Its web server is located in Sofia, Sofia-Capital, Bulgaria, with IP address 78.142.47.8. According to SiteAdvisor, vrnt.org is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$32,312 |
| Daily Ads Revenue | US$17 |
| Monthly Ads Revenue | US$531 |
| Yearly Ads Revenue | US$6,462 |
| Daily Unique Visitors | 843 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 3,676,356 |
| Delta (90 Days) | 0 |
| Most Popular In Country | N/A |
| Country Rank | N/A |
DNS Records
| Host | Type | TTL | Data |
| vrnt.org | A | 14399 | IP: 78.142.47.8 |
| vrnt.org | MX | 14399 | Priority: 0 Target: vrnt.org. |
| vrnt.org | NS | 21599 | Target: ns1.webapp2cloud.com. |
| vrnt.org | NS | 21599 | Target: ns2.webapp2cloud.com. |
| vrnt.org | TXT | 14399 | TXT: v=spf1 ip4:78.142.47.8 ip4:174.136.29.117 +a +mx +ip4:72.249.68.173 ?all |
| vrnt.org | SOA | 21599 | MNAME: ns1.webapp2cloud.com. RNAME: noc.webapp2cloud.com. Serial: 2021030500 Refresh: 3600 Retry: 1800 Expire: 1209600 Minimum TTL: 86400 |
HTTP Headers
HTTP/1.1 200 OK Date: Sun, 28 Mar 2021 06:58:38 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
Vrnt.org Whois Information
Domain Name: VRNT.ORG Registry Domain ID: D168075534-LROR Registrar WHOIS Server: whois.net4domains.com Registrar URL: http://www.net4.in Updated Date: 2021-03-12T22:32:20Z Creation Date: 2013-03-06T08:22:38Z Registry Expiry Date: 2021-03-06T08:22:38Z Registrar Registration Expiration Date: Registrar: Net 4 India Limited Registrar IANA ID: 1007 Registrar Abuse Contact Email: abuse@net4.com Registrar Abuse Contact Phone: +91.1204323500 Reseller: Domain Status: serverDeleteProhibited https://icann.org/epp#serverDeleteProhibited Registrant Organization: Sun Industrial Automation Registrant State/Province: Tamilnadu Registrant Country: IN Name Server: NS1.WEBAPP2HOST.COM Name Server: NS2.WEBAPP2HOST.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/) |